PDB entry 5jsc

View 5jsc on RCSB PDB site
Description: Crystal structure of a Putative acyl-CoA dehydrogenase from Burkholderia xenovorans
Class: oxidoreductase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2016-05-07, released 2016-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acyl-CoA dehydrogenase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B0278
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jsca1, d5jsca2
  • Chain 'B':
    Compound: putative acyl-CoA dehydrogenase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B0278
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jscb1, d5jscb2
  • Chain 'C':
    Compound: putative acyl-CoA dehydrogenase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B0278
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jscc1, d5jscc2
  • Chain 'D':
    Compound: putative acyl-CoA dehydrogenase
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: Bxe_B0278
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jscd1, d5jscd2
  • Heterogens: FAD, CL, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jscA (A:)
    mahhhhhhmsanteldlhsalawpffeprhrelaagieawcranlahedhedvdatcrrl
    vrelgaagwlkygvggvaygghgdtidtravcllretlakhsgladfalamqglgsgais
    lggtheqktrylprvangtaiaafalsepeagsdvaamtlsaredgdayvldgdktwisn
    ggiadfyvvfartgeapgargisafvvdadtpgleiaeridviaphplarlhfagarvpr
    sqmlgapgegfklamrtldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqlt
    qaklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggm
    gvqsgtavemlyreiralriyegatevqqlivgrdllkahaaatagantr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jscA (A:)
    eldlhsalawpffeprhrelaagieawcranlaedvdatcrrlvrelgaagwlkygvggv
    aygghgdtidtravcllretlakhsgladfalamqglgsgaislggtheqktrylprvan
    gtaiaafalsepeagsdvaamtlsaredgdayvldgdktwisnggiadfyvvfartgeap
    gargisafvvdadtpgleiaeridviaphplarlhfagarvprsqmlgapgegfklamrt
    ldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqltqaklaqmaltidssall
    vyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggmgvqsgtavemlyreira
    lriyegatevqqlivgrdllkahaaata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jscB (B:)
    mahhhhhhmsanteldlhsalawpffeprhrelaagieawcranlahedhedvdatcrrl
    vrelgaagwlkygvggvaygghgdtidtravcllretlakhsgladfalamqglgsgais
    lggtheqktrylprvangtaiaafalsepeagsdvaamtlsaredgdayvldgdktwisn
    ggiadfyvvfartgeapgargisafvvdadtpgleiaeridviaphplarlhfagarvpr
    sqmlgapgegfklamrtldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqlt
    qaklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggm
    gvqsgtavemlyreiralriyegatevqqlivgrdllkahaaatagantr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jscB (B:)
    eldlhsalawpffeprhrelaagieawcranladvdatcrrlvrelgaagwlkygvggva
    ygghgdtidtravcllretlakhsgladfalamqglgsgaislggtheqktrylprvang
    taiaafalsepeagsdvaamtlsaredgdayvldgdktwisnggiadfyvvfartgeapg
    argisafvvdadtpgleiaeridviaphplarlhfagarvprsqmlgapgegfklamrtl
    difrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqltqaklaqmaltidssallv
    yraawlrdqgenvtreaamakwhasegaqqvidaavqlyggmgvqsgtavemlyreiral
    riyegatevqqlivgrdllkahaaata
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jscC (C:)
    mahhhhhhmsanteldlhsalawpffeprhrelaagieawcranlahedhedvdatcrrl
    vrelgaagwlkygvggvaygghgdtidtravcllretlakhsgladfalamqglgsgais
    lggtheqktrylprvangtaiaafalsepeagsdvaamtlsaredgdayvldgdktwisn
    ggiadfyvvfartgeapgargisafvvdadtpgleiaeridviaphplarlhfagarvpr
    sqmlgapgegfklamrtldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqlt
    qaklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggm
    gvqsgtavemlyreiralriyegatevqqlivgrdllkahaaatagantr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jscC (C:)
    eldlhsalawpffeprhrelaagieawcranledvdatcrrlvrelgaagwlkygvggva
    ygghgdtidtravcllretlakhsgladfalamqglgsgaislggtheqktrylprvang
    taiaafalsepeagsdvaamtlsaredgdayvldgdktwisnggiadfyvvfartgeapg
    argisafvvdadtpgleiaeridviaphplarlhfagarvprsqmlgapgegfklamrtl
    difrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqltqaklaqmaltidssallv
    yraawlrdqgenvtreaamakwhasegaqqvidaavqlyggmgvqsgtavemlyreiral
    riyegatevqqlivgrdllkahaaatag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jscD (D:)
    mahhhhhhmsanteldlhsalawpffeprhrelaagieawcranlahedhedvdatcrrl
    vrelgaagwlkygvggvaygghgdtidtravcllretlakhsgladfalamqglgsgais
    lggtheqktrylprvangtaiaafalsepeagsdvaamtlsaredgdayvldgdktwisn
    ggiadfyvvfartgeapgargisafvvdadtpgleiaeridviaphplarlhfagarvpr
    sqmlgapgegfklamrtldifrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqlt
    qaklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlyggm
    gvqsgtavemlyreiralriyegatevqqlivgrdllkahaaatagantr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jscD (D:)
    eldlhsalawpffeprhrelaagieawcranladvdatcrrlvrelgaagwlkygvggva
    ygghgdtidtravcllretlakhsgladfalamqglgsgaislggtheqktrylprvang
    taiaafalsepeagsdvaamtlsaredgdayvldgdktwisnggiadfyvvfartgeapg
    argisafvvdadtpgleiaeridviaphplarlhfagarvprsqmlgapgegfklamrtl
    difrtsvaaaslgfarhamaegvaraasrkmfgqtlgdfqltqaklaqmaltidssallv
    yraawlrdqgenvtreaamakwhasegaqqvidaavqlyggmgvqsgtavemlyreiral
    riyegatevqqlivgrdllkahaaatag