PDB entry 5jry

View 5jry on RCSB PDB site
Description: Crystal structure of a NAD-dependent Aldehyde dehydrogenase from Burkholderia multivorans in covalent complex with NAD
Class: oxidoreductase
Keywords: SSGCID, Burkholderia, NAD-dependent aldehyde dehydrogenase, NAD, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2016-05-06, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent aldehyde dehydrogenase
    Species: Burkholderia multivorans (strain ATCC 17616 / 249) [TaxId:395019]
    Gene: BMULJ_03565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jrya_
  • Heterogens: NDP, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jryA (A:)
    mahhhhhhmlketypyylanaavyantdlevtdkysgkvatrvaladakaidaaigaavd
    atkpmrelpaykrqavldhcvarfrerfdelaealcieagkpindakgevtrlidtfrva
    seeavridgevlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpvgaliigevlaetdlpkgafsvlpahrdgadlfttddrfrllsftgspa
    vgwalkekagkkkvvlelggnaaaivdadqldrldyvvdrlafgafyqsgqscigvqril
    ahadiydalrdkliaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiva
    ggkvdgamfeatllenvgrdqdlyrkeafgpiailekfdrfddalarvndsdfglqagvf
    tdslahtqqawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprll
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jryA (A:)
    mlketypyylanaavyantdlevtdkysgkvatrvaladakaidaaigaavdatkpmrel
    paykrqavldhcvarfrerfdelaealcieagkpindakgevtrlidtfrvaseeavrid
    gevlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpas
    rtpvgaliigevlaetdlpkgafsvlpahrdgadlfttddrfrllsftgspavgwalkek
    agkkkvvlelggnaaaivdadqldrldyvvdrlafgafyqsgqscigvqrilahadiyda
    lrdkliaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakivaggkvdgam
    featllenvgrdqdlyrkeafgpiailekfdrfddalarvndsdfglqagvftdslahtq
    qawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprllvvrrr