PDB entry 5jqr

View 5jqr on RCSB PDB site
Description: The Structure of Ascorbate Peroxidase Compound II formed by reaction with m-CPBA
Class: oxidoreductase
Keywords: Heme Peroxidase, Intermediates, Compound II, Ferryl, Multicrystal, Oxidoreductase
Deposited on 2016-05-05, released 2016-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ascorbate peroxidase
    Species: Glycine max [TaxId:3847]
    Gene: apx1, GLYMA_U021900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5jqra_
  • Heterogens: HEM, K, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jqrA (A:)
    gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
    hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
    kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
    nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
    lselgfada