PDB entry 5jqd

View 5jqd on RCSB PDB site
Description: Antibody Fab Fragment
Class: immune system
Keywords: Antibody Fab Fragment, IMMUNE SYSTEM
Deposited on 2016-05-04, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D80 Fab Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JQD (0-End)
    Domains in SCOPe 2.07: d5jqda1, d5jqda2
  • Chain 'B':
    Compound: D80 Fab Fragment Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JQD (0-End)
    Domains in SCOPe 2.07: d5jqdb1, d5jqdb2
  • Chain 'C':
    Compound: D80 Fab Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JQD (0-End)
  • Chain 'D':
    Compound: D80 Fab Fragment Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JQD (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jqdA (A:)
    eivltqspgtlslspgeratlscrasqslsskylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyscqqydgvprtfgqgttveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jqdA (A:)
    eivltqspgtlslspgeratlscrasqslsskylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyscqqydgvprtfgqgttveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jqdB (B:)
    eivltqspgtlslspgeratlscrasqslsskylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyscqqydgvprtfgqgttveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jqdB (B:)
    eivltqspgtlslspgeratlscrasqslsskylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyscqqydgvprtfgqgttveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.