PDB entry 5jq1

View 5jq1 on RCSB PDB site
Description: Efficient targeting of the asialoglycoprotein receptor by polyvalent display of a compact galactosamine mimic
Class: sugar binding protein
Keywords: asialoglycoprotein receptor, carbohydrates, liver targeting, Sugar Binding Protein
Deposited on 2016-05-04, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: asialoglycoprotein receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ASGR1, CLEC4H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jq1a_
  • Chain 'B':
    Compound: asialoglycoprotein receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ASGR1, CLEC4H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jq1b_
  • Heterogens: CA, ZPF, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jq1A (A:)
    mgsertccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhig
    pvntwmglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnd
    dvcqrpyrwvceteldkasqeppll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jq1A (A:)
    tccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntw
    mglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqr
    pyrwvcetel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jq1B (B:)
    mgsertccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhig
    pvntwmglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnd
    dvcqrpyrwvceteldkasqeppll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jq1B (B:)
    ccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntwm
    glhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqrp
    yrwvcetel