PDB entry 5jpv

View 5jpv on RCSB PDB site
Description: Efficient targeting of the asialoglycoprotein receptor by polyvalent display of a compact galactoseamine mimic
Class: signaling protein
Keywords: asialoglycoprotein receptor, carbohydrates, liver targeting, SIGNALING PROTEIN
Deposited on 2016-05-04, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: asialoglycoprotein receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ASGR1, CLEC4H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jpva_
  • Chain 'B':
    Compound: asialoglycoprotein receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ASGR1, CLEC4H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jpvb_
  • Heterogens: LBT, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jpvA (A:)
    mgsertccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhig
    pvntwmglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnd
    dvcqrpyrwvceteldkasqeppll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jpvA (A:)
    cpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntwmg
    lhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqrpy
    rwvcetel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jpvB (B:)
    mgsertccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhig
    pvntwmglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnd
    dvcqrpyrwvceteldkasqeppll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jpvB (B:)
    cpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntwmg
    lhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqrpy
    rwvcetel