PDB entry 5jp1

View 5jp1 on RCSB PDB site
Description: Structure of Xanthomonas campestris effector protein XopD bound to tomato SUMO
Class: hydrolase
Keywords: Enzyme, CE clan, Deubiquitinase, DeSUMOylase, hydrolase
Deposited on 2016-05-03, released 2016-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthomonas outer protein D
    Species: Xanthomonas campestris pv. vesicatoria (strain 85-10) [TaxId:316273]
    Gene: xopD, XCV0437
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Small ubiquitin-related modifier
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: sumo
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SMD1 (Start-94)
      • expression tag (95)
    Domains in SCOPe 2.06: d5jp1b1, d5jp1b2
  • Heterogens: MLI, D1D, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jp1B (B:)
    msasggtgdedkkpndqmvhinlkvkgqdgnevffrikrstqmrklmnaycdrqsvdmns
    iaflfdgrrlraeqtpdelemeegdeidamlhqtgx
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jp1B (B:)
    vhinlkvkgqdgnevffrikrstqmrklmnaycdrqsvdmnsiaflfdgrrlraeqtpde
    lemeegdeidamlhqtgx