PDB entry 5jo4

View 5jo4 on RCSB PDB site
Description: Antibody Fab Fragment Complex
Class: immune system
Keywords: Antibody Fab Fragment Complex, IMMUNE SYSTEM
Deposited on 2016-05-01, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D80 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5JO4 (0-End)
  • Chain 'B':
    Compound: D80 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5JO4 (0-214)
    Domains in SCOPe 2.07: d5jo4b1, d5jo4b2
  • Chain 'C':
    Compound: G6 Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5JO4 (0-End)
  • Chain 'D':
    Compound: G6 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5JO4 (0-End)
    Domains in SCOPe 2.07: d5jo4d1, d5jo4d2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jo4B (B:)
    eivltqspgtlslspgeratlscrasqslsskylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyscqqydgvprtfgqgttveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jo4D (D:)
    diqltqspsslsasvgdrvtitcrasqgissnivwlqqkpgkapkgliyhgtnlesgvps
    rfsgsgsgtdytltisslepedfatyycvqysqfpptfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jo4D (D:)
    diqltqspsslsasvgdrvtitcrasqgissnivwlqqkpgkapkgliyhgtnlesgvps
    rfsgsgsgtdytltisslepedfatyycvqysqfpptfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksf