PDB entry 5jo3

View 5jo3 on RCSB PDB site
Description: PDE5A for NaV1.7
Class: hydrolase
Keywords: hydrolase
Deposited on 2016-05-01, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (Start-325)
      • conflict (124)
      • conflict (127)
      • conflict (129-137)
      • conflict (140-141)
      • insertion (143)
      • conflict (144-145)
      • conflict (147)
      • conflict (147)
      • conflict (218)
    Domains in SCOPe 2.07: d5jo3b_
  • Heterogens: ZN, 6LK, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jo3B (B:)
    eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
    vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
    dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
    lkiikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpw
    piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
    thvsedcfplldgcrknrqkwqalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jo3B (B:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlki
    ikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpiq
    qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv
    sedcfplldgcrknrqkwqalae