PDB entry 5jn5

View 5jn5 on RCSB PDB site
Description: Crystal structure of the D263Y missense variant of human PGM1
Class: isomerase
Keywords: isomerase, phosphohexomutase, enzyme
Deposited on 2016-04-29, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • expression tag (22)
      • engineered mutation (285)
    Domains in SCOPe 2.07: d5jn5a1, d5jn5a2, d5jn5a3, d5jn5a4, d5jn5a5
  • Chain 'B':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (Start-584)
      • engineered mutation (285)
    Domains in SCOPe 2.07: d5jn5b1, d5jn5b2, d5jn5b3, d5jn5b4
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jn5A (A:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpypnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatirly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jn5A (A:)
    nmvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvv
    ggdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashn
    pggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlen
    kfkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilce
    elgapansavncvpledfgghhpypnltyaadlvetmksgehdfgaafdgdgdrnmilgk
    hgffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgw
    kffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqk
    ygrnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdp
    vdgsisrnqglrliftdgsrivfrlsggatirlyidsyekdvakinqdpqvmlaplisia
    lkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jn5B (B:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpypnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatirly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jn5B (B:)
    vkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpypnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqkyg
    rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
    gsisrnqglrliftdgsrivfrlsgatirlyidsyekdvakinqdpqvmlaplisialkv
    sqlqertgrtaptvit