PDB entry 5jmz

View 5jmz on RCSB PDB site
Description: Carbonic Anhydrase IX-mimic IN Complex WITH U-NO2
Class: lyase/lyase inhibitor
Keywords: CAIX inhibitors, pH regulation, cancer therapeutics, transmembrane, LYASE-LYASE INHIBITOR complex
Deposited on 2016-04-29, released 2017-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-256)
      • conflict (61)
      • conflict (63)
      • conflict (65)
      • conflict (87)
      • conflict (126)
      • conflict (165)
      • conflict (199)
    Domains in SCOPe 2.08: d5jmza_
  • Heterogens: ZN, DMS, AYX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jmzA (A:)
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk