PDB entry 5jmr

View 5jmr on RCSB PDB site
Description: X-ray structure of the furin inhibitory antibody Nb14
Class: immune system
Keywords: camelid, antibody, inhibitor, furin, immune system
Deposited on 2016-04-29, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camelid VHH fragment
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5JMR
    Domains in SCOPe 2.07: d5jmra1, d5jmra2
  • Chain 'B':
    Compound: camelid VHH fragment
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5JMR
    Domains in SCOPe 2.07: d5jmrb1, d5jmrb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jmrA (A:)
    maqvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsnt
    dyadsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jmrA (A:)
    qvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsntdy
    adsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jmrB (B:)
    maqvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsnt
    dyadsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jmrB (B:)
    qvqlqesggglvqpggsltlscaasgftfssysmywvrqapgkglewvssinrvgsntdy
    adsvkgrftisrdnakntlylqmnslksedtalyycavgmyaappwrgqgtqvtvs