PDB entry 5jmc

View 5jmc on RCSB PDB site
Description: Receptor binding domain of Botulinum neurotoxin A in complex with rat SV2C
Class: hydrolase
Keywords: hydrolase
Deposited on 2016-04-28, released 2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10845 (4-428)
      • expression tag (0-3)
      • engineered mutation (290)
      • expression tag (429-430)
    Domains in SCOPe 2.06: d5jmca1, d5jmca2, d5jmca3, d5jmca4
  • Chain 'B':
    Compound: Synaptic vesicle glycoprotein 2C
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sv2c
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10845 (4-428)
      • expression tag (0-3)
      • engineered mutation (290)
      • expression tag (429)
    Domains in SCOPe 2.06: d5jmcc1, d5jmcc2, d5jmcc3, d5jmcc4
  • Chain 'D':
    Compound: Synaptic vesicle glycoprotein 2C
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sv2c
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10845 (4-428)
      • expression tag (0-3)
      • engineered mutation (290)
      • expression tag (429)
    Domains in SCOPe 2.06: d5jmce1, d5jmce2, d5jmce3, d5jmce4
  • Chain 'F':
    Compound: Synaptic vesicle glycoprotein 2C
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sv2c
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10845 (4-428)
      • expression tag (0-3)
      • engineered mutation (290)
      • expression tag (429-430)
    Domains in SCOPe 2.06: d5jmcg1, d5jmcg2, d5jmcg3, d5jmcg4
  • Chain 'H':
    Compound: Synaptic vesicle glycoprotein 2C
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sv2c
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jmcA (A:)
    gshmniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievi
    lknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtl
    qdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgni
    hasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqy
    dkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgakfiikkyas
    gnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskn
    dqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipv
    ddgwgerpllvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jmcA (A:)
    gshmniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievi
    lknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtl
    qdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgni
    hasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqy
    dkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgakfiikkygn
    kdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskitn
    kckmnlqdnngndigfigfhqfnniaklvasnwynrqrtlgcswefipvddgwgerpllv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jmcC (C:)
    gshmniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievi
    lknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtl
    qdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgni
    hasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqy
    dkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgakfiikkyas
    gnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskn
    dqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipv
    ddgwgerpllvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jmcC (C:)
    gshmniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievi
    lknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtl
    qdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgni
    hasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqy
    dkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgakfiikkykd
    nivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndtnk
    ckmnlqdnngndigfigfhqfnniaklvasnwynrqtlgcswefipvddgwgerpll
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5jmcE (E:)
    gshmniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievi
    lknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtl
    qdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgni
    hasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqy
    dkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgakfiikkyas
    gnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskn
    dqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipv
    ddgwgerpllvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jmcE (E:)
    gshmniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievi
    lknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtl
    qdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgni
    hasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqy
    dkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgakfiikkynk
    dnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndtn
    kckmnlqdnngndigfigfhqfnniaklvasnwynrqrtlgcswefipvddgwgerpll
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5jmcG (G:)
    gshmniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievi
    lknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtl
    qdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgni
    hasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqy
    dkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgakfiikkyas
    gnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskn
    dqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqierssrtlgcswefipv
    ddgwgerpllvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jmcG (G:)
    gshmniintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievi
    lknaivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtl
    qdtqeikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgni
    hasnnimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqsnsgilkdfwgdylqy
    dkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnsslyrgakfiikkynk
    dnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskndtn
    kckmnlqdnngndigfigfhqfnniaklvasnwynrqtlgcswefipvddgwgerpllv
    

  • Chain 'H':
    No sequence available.