PDB entry 5jkf

View 5jkf on RCSB PDB site
Description: Crystal structure of esterase E22
Class: hydrolase
Keywords: Esterase E32, HYDROLASE
Deposited on 2016-04-26, released 2017-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase E22
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JKF (0-End)
    Domains in SCOPe 2.06: d5jkfa_
  • Chain 'B':
    Compound: Esterase E22
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JKF (0-End)
    Domains in SCOPe 2.06: d5jkfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jkfA (A:)
    mvekrvfemphfttfggkqiknvkvgweaygtlndaksnvilithyfsgsshaagkyden
    dpapgywdsiigpgkaidtdrfyvisvdtlanlnaydphvittgptsinpdtgkpygldf
    pvvtirdfvnvqkalleslgisklyavigpsmgsmqaidwasaypgwvermisvigagqs
    dawttaalehwatpitldknwnngayskeqaplnglaaslmlitqnaltpsffnqtgntl
    gyknvesaplndirqshsivnwlreraktraksmdanhllylvracqlfvaghqgnleqg
    lasikaktlfipaqtdlllmpylsqsahqgltsmnndstlvtlngklghlegvtnvsaqa
    qairqflend
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jkfA (A:)
    mvekrvfemphfttfggkqiknvkvgweaygtlndaksnvilithyfsgsshaagkyden
    dpapgywdsiigpgkaidtdrfyvisvdtlanlnaydphvittgptsinpdtgkpygldf
    pvvtirdfvnvqkalleslgisklyavigpsmgsmqaidwasaypgwvermisvigagqs
    dawttaalehwatpitldknwnngayskeqaplnglaaslmlitqnaltpsffnqtgntl
    gyknvesaplndirqshsivnwlreraktraksmdanhllylvracqlfvaghqgnleqg
    lasikaktlfipaqtdlllmpylsqsahqgltsmnndstlvtlngklghlegvtnvsaqa
    qairqflen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jkfB (B:)
    mvekrvfemphfttfggkqiknvkvgweaygtlndaksnvilithyfsgsshaagkyden
    dpapgywdsiigpgkaidtdrfyvisvdtlanlnaydphvittgptsinpdtgkpygldf
    pvvtirdfvnvqkalleslgisklyavigpsmgsmqaidwasaypgwvermisvigagqs
    dawttaalehwatpitldknwnngayskeqaplnglaaslmlitqnaltpsffnqtgntl
    gyknvesaplndirqshsivnwlreraktraksmdanhllylvracqlfvaghqgnleqg
    lasikaktlfipaqtdlllmpylsqsahqgltsmnndstlvtlngklghlegvtnvsaqa
    qairqflend
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jkfB (B:)
    mvekrvfemphfttfggkqiknvkvgweaygtlndaksnvilithyfsgsshaagkyden
    dpapgywdsiigpgkaidtdrfyvisvdtlanlnaydphvittgptsinpdtgkpygldf
    pvvtirdfvnvqkalleslgisklyavigpsmgsmqaidwasaypgwvermisvigagqs
    dawttaalehwatpitldknwnngayskeqaplnglaaslmlitqnaltpsffnqtgntl
    gyknvesaplndirqshsivnwlreraktraksmdanhllylvracqlfvaghqgnleqg
    lasikaktlfipaqtdlllmpylsqsahqgltsmnndstlvtlngklghlegvtnvsaqa
    qairqfle