PDB entry 5jjg

View 5jjg on RCSB PDB site
Description: Structure of magnesium-loaded ALG-2
Class: apoptosis
Keywords: ALG-2, penta-EF-HAND PROTEIN, CALCIUM BINDING PROTEIN, APOPTOSIS, Apoptosis-Linked Gene 2
Deposited on 2016-04-23, released 2016-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pcalcium-binding protein ALG-2, rogrammed cell death protein 6
    Species: Mus musculus [TaxId:10090]
    Gene: PDCD6, ALG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jjga_
  • Heterogens: MG, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jjgA (A:)
    mdqsflwnvfqrvdkdrsgvisdnelqqalsngtwtpfnpvtvrsiismfdrenkagvnf
    seftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqg
    rgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jjgA (A:)
    dqsflwnvfqrvdkdrsgvisdnelqqalsngtwtpfnpvtvrsiismfdrenkagvnfs
    eftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgr
    gqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv