PDB entry 5jjd

View 5jjd on RCSB PDB site
Description: crystal structure of the ceramide transfer protein PH and START domain complex
Class: lipid transport
Keywords: CERT, PH, START, complex, LIPID TRANSPORT
Deposited on 2016-04-23, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen type IV alpha-3-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3BP, CERT, STARD11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jjda_
  • Chain 'B':
    Compound: Collagen type IV alpha-3-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: COL4A3BP, CERT, STARD11
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jjdA (A:)
    gefsgppvercgvlskwtnyihgwqdrwvvlknnalsyyksedeteygcrgsiclskavi
    tphdfdecrfdisvndsvwylraqdpdhrqqwidaieqhktesgyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jjdA (A:)
    vercgvlskwtnyihgwqdrwvvlknnalsyyksedeteygcrgsiclskavitphdfde
    crfdisvndsvwylraqdpdhrqqwidaieqhktesg
    

  • Chain 'B':
    No sequence available.