PDB entry 5jih

View 5jih on RCSB PDB site
Description: Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
Class: immune system
Keywords: Immune system, antibody engineering, immunoglobulin G1, Fc fragment, glycosylations, CH3 domain, Fcab, HER2, erbB-2
Deposited on 2016-04-22, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (133-137)
      • engineered mutation (188-190)
      • insertion (190)
      • insertion (190)
      • insertion (190)
      • insertion (190)
      • insertion (190)
      • engineered mutation (198-199)
    Domains in SCOPe 2.07: d5jiha1, d5jiha2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (133-137)
      • engineered mutation (188-190)
      • insertion (190)
      • insertion (190)
      • insertion (190)
      • insertion (190)
      • insertion (190)
      • engineered mutation (198-199)
    Domains in SCOPe 2.07: d5jihb1, d5jihb2
  • Heterogens: NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jihA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeylsdsvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvprhsetmrrwahgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jihA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eylsdsvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvprhs
    etmrrwahgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jihB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeylsdsvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvprhsetmrrwahgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jihB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eylsdsvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvprhs
    etmrrwahgnvfscsvmhealhnhytqkslsl