PDB entry 5jhm

View 5jhm on RCSB PDB site
Description: Crystal structure of Zika virus Envelope protein
Class: viral protein
Keywords: Zika virus, Envelop protein, VIRAL PROTEIN
Deposited on 2016-04-21, released 2016-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JHM
    Domains in SCOPe 2.06: d5jhma1, d5jhma2
  • Chain 'B':
    Compound: envelope protein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JHM
    Domains in SCOPe 2.06: d5jhmb1, d5jhmb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jhmA (A:)
    mircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsy
    cyeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakf
    acskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeat
    lggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnk
    ealvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklr
    lkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrli
    tanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jhmA (A:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsenrakveitpnspraeatlggfgslgldceprtg
    ldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdahakrqtv
    vvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsyslctaaftft
    kipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmm
    leldppfgdsyivigvgekkithhwhrsgst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jhmB (B:)
    mircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsy
    cyeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakf
    acskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeat
    lggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnk
    ealvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklr
    lkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrli
    tanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jhmB (B:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsenrakveitpnspraeatlggfgslgldceprtg
    ldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdahakrqtv
    vvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsyslctaaftft
    kipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmm
    leldppfgdsyivigvgekkithhwhrsgs