PDB entry 5jhl

View 5jhl on RCSB PDB site
Description: Crystal structure of zika virus envelope protein in complex with a flavivirus broadly-protective antibody
Class: viral protein/immune system
Keywords: zika virus, envelope protein, flavivirus, broadly-protective antibody, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2016-04-21, released 2016-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JHL
    Domains in SCOPe 2.06: d5jhla1, d5jhla2
  • Chain 'H':
    Compound: antibody heavy chain
    Species: Mus [TaxId:10088]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JHL
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Mus [TaxId:10088]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JHL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jhlA (A:)
    mircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsy
    cyeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakf
    acskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeat
    lggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnk
    ealvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklr
    lkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrli
    tanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jhlA (A:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhnrakveitpnspraeatlggfgslgldceprtgldf
    sdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdahakrqtvvvl
    gsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsyslctaaftftkip
    aetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmmlel
    dppfgdsyivigvgekkithhwhrs
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.