PDB entry 5jhg

View 5jhg on RCSB PDB site
Description: Crystal structure of the complex between the human RhoA and the DH/PH domain of human ARHGEF11
Class: signaling protein/transcription
Keywords: RhoA-ARHRhoGEF11 complex, target-based pharmaceutical design, SIGNALING PROTEIN-TRANSCRIPTION complex
Deposited on 2016-04-21, released 2017-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 11
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF11, KIAA0380
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jhga1, d5jhga2
  • Chain 'B':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jhgb_
  • Chain 'E':
    Compound: Rho guanine nucleotide exchange factor 11
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF11, KIAA0380
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jhge1, d5jhge2
  • Chain 'F':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jhgf_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jhgA (A:)
    mqnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpr
    eelarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqf
    csyqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesi
    ikhteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrldatalerasnpl
    aaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqdeklllkchskta
    vgssdskqtfspvlklnavlirsvatdkraffiictsklgppqiyelvaltssdkntwme
    lleeavrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jhgA (A:)
    qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre
    elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc
    syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii
    khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrldatalerasnpla
    aefksldlttrkmihegpltwriskdktldlhvllledllvllqkqdeklllkchtfspv
    lklnavlirsvatdkraffiictsklgppqiyelvaltssdkntwmelleeavrna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jhgB (B:)
    maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jhgB (B:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5jhgE (E:)
    mqnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpr
    eelarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqf
    csyqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesi
    ikhteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrldatalerasnpl
    aaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqdeklllkchskta
    vgssdskqtfspvlklnavlirsvatdkraffiictsklgppqiyelvaltssdkntwme
    lleeavrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jhgE (E:)
    qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre
    elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc
    syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii
    khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrldatalerasnpla
    aefksldlttrkmihegpltwriskdktldlhvllledllvllqkqdeklllkchsktfs
    pvlklnavlirsvatdkraffiictsklgppqiyelvaltssdkntwmelleeavrna
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5jhgF (F:)
    maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
    agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jhgF (F:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq