PDB entry 5jd7

View 5jd7 on RCSB PDB site
Description: PKG I's Carboxyl Terminal Cyclic Nucleotide Binding Domain (CNB-B) in a complex with PET-cGMP
Class: protein binding
Keywords: Binding Sites, Cyclic AMP, Cyclic GMP, Cyclic GMP-Dependent Protein Kinase Type II, Mutagenesis, Site-Directed, Protein Binding, analogs
Deposited on 2016-04-15, released 2017-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jd7a_
  • Heterogens: 6JR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jd7A (A:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsf
    khligglddvsnkay
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jd7A (A:)
    ikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtv
    nvtrededpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhliggld
    dvsnkay