PDB entry 5jbo

View 5jbo on RCSB PDB site
Description: Trichoderma harzianum GH1 beta-glucosidase ThBgl2
Class: hydrolase
Keywords: GH1, beta-glucosidase, Trichoderma harzianum, HYDROLASE
Deposited on 2016-04-13, released 2017-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: TRICHODERMA HARZIANUM [TaxId:5544]
    Gene: THAR02_02251
    Database cross-references and differences (RAF-indexed):
    • PDB 5JBO
    Domains in SCOPe 2.06: d5jboa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jboA (A:)
    mmseslslpkdfewgfataayqiegavkeggrgpsiwdtychlepsrtngangdvacdhy
    hrydedfdlltkygakayrfslswsriiplggrldpineegiqfysnlidallkrgvtpw
    vtlyhwdlpqalhdryggwlnvkevqldferyarlcferfgdrvknwitinepwiqsiyg
    yatgsnapgrssinkhstegdtttepwlagkaqimsharavavyskdfrasqkgqigisl
    ngdyyepwdssdprdkeaaerrmefhigwyanpiflkkdypasmrkqlgdrlpaltpadf
    ailnagetdfygmnyytsqfarhyegpvpktdflgaihehqenkdgspvgeesgifwlrs
    cpdmfrkhlarvhglygkpiyitengcpcpgedkmtceeaindpfriqyfdshldsiska
    isqdgvvvkgyfawalldnlewsdgygprfgvtytdyttlkrtpkksalvlkdmfadrqr
    vkvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jboA (A:)
    lslpkdfewgfataayqiegavkeggrgpsiwdtychlepsrtngangdvacdhyhryde
    dfdlltkygakayrfslswsriiplggrldpineegiqfysnlidallkrgvtpwvtlyh
    wdlpqalhdryggwlnvkevqldferyarlcferfgdrvknwitinepwiqsiygyatgs
    napgrssinkhstegdtttepwlagkaqimsharavavyskdfrasqkgqigislngdyy
    epwdssdprdkeaaerrmefhigwyanpiflkkdypasmrkqlgdrlpaltpadfailna
    getdfygmnyytsqfarhyegpvpktdflgaihehqenkdgspvgeesgifwlrscpdmf
    rkhlarvhglygkpiyitengcpcpgedkmtceeaindpfriqyfdshldsiskaisqdg
    vvvkgyfawalldnlewsdgygprfgvtytdyttlkrtpkksalvlkdmfadrqr