PDB entry 5jbk

View 5jbk on RCSB PDB site
Description: Trichoderma harzianum GH1 beta-glucosidase ThBgl1
Class: hydrolase
Keywords: beta-glucosidase, GH1, Trichoderma harzianum, HYDROLASE
Deposited on 2016-04-13, released 2017-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: TRICHODERMA HARZIANUM [TaxId:5544]
    Gene: THAR02_05432
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F9ZQA8 (1-End)
      • initiating methionine (0)
      • conflict (335)
      • conflict (462)
    Domains in SCOPe 2.06: d5jbka_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: TRICHODERMA HARZIANUM [TaxId:5544]
    Gene: THAR02_05432
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F9ZQA8 (1-End)
      • initiating methionine (0)
      • conflict (335)
      • conflict (462)
    Domains in SCOPe 2.06: d5jbkb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jbkA (A:)
    mmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtae
    diallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfh
    wdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfneplcsaipgygsgtf
    apgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldr
    eaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhyts
    nyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskryny
    pkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslm
    dnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliake
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jbkA (A:)
    mmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtae
    diallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfh
    wdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfneplcsaipgygsgtf
    apgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldr
    eaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhyts
    nyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskryny
    pkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslm
    dnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jbkB (B:)
    mmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtae
    diallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfh
    wdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfneplcsaipgygsgtf
    apgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldr
    eaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhyts
    nyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskryny
    pkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslm
    dnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliake
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jbkB (B:)
    mmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtae
    diallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfh
    wdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfneplcsaipgygsgtf
    apgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldr
    eaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhyts
    nyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskryny
    pkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslm
    dnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak