PDB entry 5ja9

View 5ja9 on RCSB PDB site
Description: Crystal structure of the HigB2 toxin in complex with Nb6
Class: toxin
Keywords: toxin-antitoxin system, toxin
Deposited on 2016-04-12, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody 6
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JA9 (0-122)
    Domains in SCOPe 2.06: d5ja9a1, d5ja9a2
  • Chain 'B':
    Compound: Nanobody 6
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JA9 (0-End)
    Domains in SCOPe 2.06: d5ja9b1, d5ja9b2
  • Chain 'C':
    Compound: Toxin HigB-2
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: higB-2, VC_A0468
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Toxin HigB-2
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: higB-2, VC_A0468
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ja9A (A:)
qvqlqesggglvqpggslrlscaasgftfsnyamrwyrqapgeerefvafissvggstny
adsvkgrftisrdngkntlylqmnslkpedtavyfcvarlslisdswgqgtqvtvsshhh
hhh

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5ja9B (B:)
qvqlqesggglvqpggslrlscaasgftfsnyamrwyrqapgeerefvafissvggstny
adsvkgrftisrdngkntlylqmnslkpedtavyfcvarlslisdswgqgtqvtvsshhh
hhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5ja9B (B:)
qvqlqesggglvqpggslrlscaasgftfsnyamrwyrqapgeerefvafissvggstny
adsvkgrftisrdngkntlylqmnslkpedtavyfcvarlslisdswgqgtqvtvsshhh
hh

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.