PDB entry 5j8n

View 5j8n on RCSB PDB site
Description: Exonuclease III homologue Mm3148 from Methanosarcina mazei
Class: hydrolase
Keywords: exonuclease III homologue, endonuclease, magnesium binding, hydrolase
Deposited on 2016-04-08, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease III
    Species: Methanosarcina mazei [TaxId:192952]
    Gene: MM_3148
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PSD1 (0-256)
      • engineered mutation (0)
      • engineered mutation (116)
      • engineered mutation (207)
      • expression tag (257)
    Domains in SCOPe 2.07: d5j8na1, d5j8na2
  • Heterogens: MG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5j8nA (A:)
    aehynliswnvnglraavkkgfldlllehrfdivcvqetkvsqdklprevkniqgyynyf
    vsaeqngysgvgtfsknkpiklekgmgievfdregrflrtdyedfvllniyfpngkmsqe
    rlgykmafydafldyanalksegkklvicgdvntahkeidlarpkqnemisgflpeeraw
    mdkflaagyldsfrmfnpeggnyswwsyrtgarsrnvgwrldyvfvsenlrenvksasiy
    peimgsdhcpvglelefv