PDB entry 5j80

View 5j80 on RCSB PDB site
Description: Crystal Structure of Apo Hsp90-alpha N-domain L107A mutant
Class: chaperone
Keywords: Apo structure, chaperone, L107A
Deposited on 2016-04-07, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5j80a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j80A (A:)
    dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
    kldsgkelhinlipnkqdrtltivdtgigmtkadlinnagtiaksgtkafmealqagadi
    smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
    hlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j80A (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnagtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfvek