PDB entry 5j77

View 5j77 on RCSB PDB site
Description: Mutant glyceraldehyde dehydrogenase (F34M+S405N) from Thermoplasma acidophilum
Class: oxidoreductase
Keywords: oxidoreductase, nadp-dependent dehydrogenase
Deposited on 2016-04-06, released 2017-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) [TaxId:273075]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK01 (0-End)
      • engineered mutation (33)
      • engineered mutation (404)
    Domains in SCOPe 2.07: d5j77a_
  • Chain 'B':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) [TaxId:273075]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK01 (0-End)
      • engineered mutation (33)
      • engineered mutation (404)
    Domains in SCOPe 2.07: d5j77b_
  • Chain 'C':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) [TaxId:273075]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK01 (0-End)
      • engineered mutation (33)
      • engineered mutation (404)
    Domains in SCOPe 2.07: d5j77c_
  • Chain 'D':
    Compound: D-glyceraldehyde dehydrogenase (NADP(+))
    Species: Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) [TaxId:273075]
    Gene: Ta0809
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK01 (0-End)
      • engineered mutation (33)
      • engineered mutation (404)
    Domains in SCOPe 2.07: d5j77d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j77A (A:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j77A (A:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j77B (B:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j77B (B:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5j77C (C:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j77C (C:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5j77D (D:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlfqsgrpvlgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j77D (D:)
    mdtklyidgqwvnsssgktvdkyspvtgqvigrmeaatrddvdraidaaedafwawndlg
    sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
    evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
    aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
    maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
    fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
    yfflptiignadqkskifqeeifapvigarkissveemydlandnkyglasylftkdpni
    ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
    plhintvrddlf