PDB entry 5j6b

View 5j6b on RCSB PDB site
Description: Crystal structure of Aldehyde dehydrogenase from Burkholderia thailandensis in covelent complex with NADPH
Class: oxidoreductase
Keywords: SSGCID, ALDEHYDE DEHYDROGENASE, NADP, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2016-04-04, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_II0498, DR63_5272
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2T801 (8-484)
      • expression tag (4-7)
    Domains in SCOPe 2.07: d5j6ba1, d5j6ba2
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_II0498, DR63_5272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j6bb_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_II0498, DR63_5272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j6bc_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) [TaxId:271848]
    Gene: BTH_II0498, DR63_5272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5j6bd_
  • Heterogens: CL, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j6bA (A:)
    mahhhhhhmlketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavg
    aqkplralpafrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrva
    aeesvriegglvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgspt
    vgwelkkkagkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqrii
    ahadvydalrekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakiva
    ggkvdgamfeatllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvf
    tdslshaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlm
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j6bA (A:)
    hhhhmlketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavgaqkp
    lralpafrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrvaaees
    vriegglvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagcpfvl
    kpasrtpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgsptvgwe
    lkkkagkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqriiahad
    vydalrekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakivaggkv
    dgamfeatllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvftdsl
    shaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlmvvrr
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j6bB (B:)
    mahhhhhhmlketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavg
    aqkplralpafrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrva
    aeesvriegglvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgspt
    vgwelkkkagkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqrii
    ahadvydalrekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakiva
    ggkvdgamfeatllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvf
    tdslshaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlm
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j6bB (B:)
    lketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavgaqkplralp
    afrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrvaaeesvrieg
    glvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpasr
    tpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgsptvgwelkkka
    gkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqriiahadvydal
    rekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakivaggkvdgamf
    eatllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvftdslshaqr
    awdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlmvvrrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5j6bC (C:)
    mahhhhhhmlketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavg
    aqkplralpafrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrva
    aeesvriegglvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgspt
    vgwelkkkagkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqrii
    ahadvydalrekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakiva
    ggkvdgamfeatllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvf
    tdslshaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlm
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j6bC (C:)
    lketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavgaqkplralp
    afrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrvaaeesvrieg
    glvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpasr
    tpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgsptvgwelkkka
    gkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqriiahadvydal
    rekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakivaggkvdgamf
    eatllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvftdslshaqr
    awdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlmvvrrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5j6bD (D:)
    mahhhhhhmlketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavg
    aqkplralpafrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrva
    aeesvriegglvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgspt
    vgwelkkkagkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqrii
    ahadvydalrekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakiva
    ggkvdgamfeatllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvf
    tdslshaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlm
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j6bD (D:)
    mlketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavgaqkplral
    pafrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrvaaeesvrie
    gglvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpas
    rtpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgsptvgwelkkk
    agkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqriiahadvyda
    lrekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakivaggkvdgam
    featllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvftdslshaq
    rawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlmvvrrr