PDB entry 5j5v

View 5j5v on RCSB PDB site
Description: CdiA-CT from uropathogenic Escherichia coli in complex with cognate immunity protein and CysK
Class: toxin
Keywords: complex, toxin, endonuclease, immunity protein
Deposited on 2016-04-04, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase A
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: cysK, Z3680, ECs3286
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABK6
      • engineered mutation (1)
    Domains in SCOPe 2.07: d5j5va_
  • Chain 'B':
    Compound: tRNA nuclease CdiA
    Species: Escherichia coli O6:K15:H31 (strain 536 / UPEC) [TaxId:362663]
    Gene: cdiA, ECP_4580
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Immunity protein CdiI
    Species: Escherichia coli O6:K15:H31 (strain 536 / UPEC) [TaxId:362663]
    Gene: cdiI, ECP_4579
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cysteine synthase A
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: cysK, Z3680, ECs3286
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABK6
      • engineered mutation (1)
    Domains in SCOPe 2.07: d5j5vd_
  • Chain 'E':
    Compound: tRNA nuclease CdiA
    Species: Escherichia coli O6:K15:H31 (strain 536 / UPEC) [TaxId:362663]
    Gene: cdiA, ECP_4580
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Immunity protein CdiI
    Species: Escherichia coli O6:K15:H31 (strain 536 / UPEC) [TaxId:362663]
    Gene: cdiI, ECP_4579
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j5vA (A:)
    mgkifednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlk
    pgvelveptsgntgialayvaaargykltltmpetmsierrkllkalganlvltegakgm
    kgaiqkaeeivasnpekylllqqfsnpanpeihekttgpeiwedtdgqvdvfiagvgtgg
    tltgvsryikgtkgktdlisvaveptdspviaqalageeikpgphkiqgigagfipanld
    lklvdkvigitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilp
    ssgerylstalfadlftekelqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j5vA (A:)
    gkifednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
    gvelveptsgntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasnpekylllqqfsnpanpeihekttgpeiwedtdgqvdvfiagvgtggt
    ltgvsryikgtkgktdlisvaveptdspviaqalageeikpgphkiqgigagfipanldl
    klvdkvigitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sgerylstalfad
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5j5vD (D:)
    mgkifednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlk
    pgvelveptsgntgialayvaaargykltltmpetmsierrkllkalganlvltegakgm
    kgaiqkaeeivasnpekylllqqfsnpanpeihekttgpeiwedtdgqvdvfiagvgtgg
    tltgvsryikgtkgktdlisvaveptdspviaqalageeikpgphkiqgigagfipanld
    lklvdkvigitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilp
    ssgerylstalfadlftekelqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j5vD (D:)
    gkifednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
    gvelveptsgntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasnpekylllqqfsnpanpeihekttgpeiwedtdgqvdvfiagvgtggt
    ltgvsryikgtkgktdlisvaveptdspviaqalageeikpgphkiqgigagfipanldl
    klvdkvigitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sgerylstalfad
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.