PDB entry 5j58

View 5j58 on RCSB PDB site
Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor (Chem 1856)
Class: Ligase/Ligase Inhibitor
Keywords: synthetase, ligase, methionine, inhibitor, Ligase-Ligase Inhibitor complex
Deposited on 2016-04-01, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:185431]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91
      • engineered mutation (77)
      • engineered mutation (220-222)
      • engineered mutation (267)
      • engineered mutation (271)
    Domains in SCOPe 2.07: d5j58a1, d5j58a2
  • Chain 'B':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:185431]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91 (5-End)
      • expression tag (0-4)
      • engineered mutation (77)
      • engineered mutation (220-222)
      • engineered mutation (267)
      • engineered mutation (271)
    Domains in SCOPe 2.07: d5j58b1, d5j58b2, d5j58b3
  • Heterogens: MET, GOL, DMS, N56, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j58A (A:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrstentk
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j58A (A:)
    vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
    kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
    ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
    ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
    ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
    lpkkivahgwwtkvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlngelad
    tlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaiiav
    fdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifdml
    gvpevhrkgienfefgavppgtrlgpavegevlfskrst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j58B (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrstentk
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j58B (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgnpckvslesghvvtwvseenymfrlsafrerl
    lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld
    altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl
    plpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdk
    nmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyy
    lipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspi
    lprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrst