PDB entry 5j3u

View 5j3u on RCSB PDB site
Description: Co-crystal structure of the regulatory domain of Toxoplasma gondii PKA with cAMP
Class: transferase
Keywords: Kinase, regulatory domain, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2016-03-31, released 2016-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Kinase A
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: TGME49_311300, TGVEG_311300
    Database cross-references and differences (RAF-indexed):
    • Uniprot S8EY88 (13-260)
      • expression tag (0-12)
    Domains in SCOPe 2.06: d5j3ua1, d5j3ua2, d5j3ua3
  • Heterogens: CMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5j3uA (A:)
    vyekdegqkeqlerilrqsflfnsldekdlntvilamqekkieastcliregddgeclyi
    vqsgelncsklidgeervvkvvgpgdafgelallynapraatvtsvsacdlwelgrdtfn
    aivkdaatkrrsmydsflksvhildgmdayergkvadalrtemftdgayivrqgelgdvf
    yiveegsavatksfgpgqppievkkyqagdyfgelalineepraanviahgickvacler
    ksfkrlmgsvqdllskkasey