PDB entry 5j3j

View 5j3j on RCSB PDB site
Description: Crystal Structure of human DPP-IV in complex with HL1
Class: hydrolase
Keywords: human DPP-IV, protease, HYDROLASE
Deposited on 2016-03-31, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5j3ja1, d5j3ja2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5j3jb1, d5j3jb2
  • Heterogens: HL1, NAG, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j3jA (A:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslpghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j3jA (A:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j3jB (B:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslpghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j3jB (B:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp