PDB entry 5j18

View 5j18 on RCSB PDB site
Description: Solution structure of Ras Binding Domain (RBD) of B-Raf complexed with Rigosertib (Complex I)
Class: protein binding
Keywords: mapk, pi3k, protein binding
Deposited on 2016-03-29, released 2016-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5j18a_
  • Heterogens: 6FS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5j18A (A:)
    gslevlfqgpspqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyri
    qdgekkpigwdtdiswltgeelhvevlenvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j18A (A:)
    spqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpigw
    dtdiswltgeelhvevlenvpl