PDB entry 5j13

View 5j13 on RCSB PDB site
Description: Structural basis for TSLP antagonism by the therapeutic antibody Tezepelumab (MEDI9929 / AMG-157)
Class: immune system
Keywords: cytokine inflammation TSLP antibody, IMMUNE SYSTEM
Deposited on 2016-03-28, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymic stromal lymphopoietin
    Species: Homo sapiens [TaxId:9606]
    Gene: Tslp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969D9 (21-End)
      • expression tag (20)
  • Chain 'B':
    Compound: anti-TSLP Fab-fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5J13
    Domains in SCOPe 2.07: d5j13b1, d5j13b2
  • Chain 'C':
    Compound: anti-TSLP Fab-fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5J13
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5j13B (B:)
    mgilpspgmpallslvsllsvllmgcvaetgsyvltqppsvsvapgqtaritcggnnlgs
    ksvhwyqqkpgqapvlvvyddsdrpswiperfsgsnsgntatltisrgeagdeadyycqv
    wdsssdhvvfgggtkltvlgqpkaapsvtlfppsseelqankatlvclisdfypgavtva
    wkadsspvkagvetttpskqsnnkyaassylsltpeqwkshrsyscqvthegstvektva
    ptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5j13B (B:)
    syvltqppsvsvapgqtaritcggnnlgsksvhwyqqkpgqapvlvvyddsdrpswiper
    fsgsnsgntatltisrgeagdeadyycqvwdsssdhvvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'C':
    No sequence available.