PDB entry 5ixk

View 5ixk on RCSB PDB site
Description: RORgamma in complex with inverse agonist BIO399.
Class: immune system
Keywords: RORgamma, Nuclear hormone receptor, Inverse agonist, AF2 helix, IMMUNE SYSTEM
Deposited on 2016-03-23, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ixka_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ixkb_
  • Heterogens: 6EW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ixkA (A:)
    gptpeapyteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwer
    cahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffe
    gkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkv
    eqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ixkA (A:)
    eiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlteai
    qyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmelf
    ralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynlel
    afhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ixkB (B:)
    gptpeapyteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwer
    cahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffe
    gkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkv
    eqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ixkB (B:)
    teiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhltea
    iqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmel
    fralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynle
    lafhhhlckthrqsilaklppkgklrslcsqhverlqifq