PDB entry 5ixj

View 5ixj on RCSB PDB site
Description: Tryptophan Synthase beta-subunit from Pyrococcus furiosus with L-threonine non-covalently bound in the active site
Class: lyase
Keywords: Substrate analog, Lyase, PLP, Fold-type II
Deposited on 2016-03-23, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ixja_
  • Chain 'B':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-387)
      • expression tag (388-390)
    Domains in SCOPe 2.07: d5ixjb1, d5ixjb2
  • Chain 'C':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ixjc_
  • Chain 'D':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U093 (0-387)
      • expression tag (388-395)
    Domains in SCOPe 2.07: d5ixjd1, d5ixjd2
  • Heterogens: THR, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ixjA (A:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ixjA (A:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ixjB (B:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ixjB (B:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqgqikpthsiapgldypg
    vgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakemsrd
    eiiivnlsgrgdkdldivlkvsgnvleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ixjC (C:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ixjC (C:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ixjD (D:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ixjD (D:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdgqikpthsiapgldyp
    gvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakemsr
    deiiivnlsgrgdkdldivlkvsgnvlehhhhhh