PDB entry 5iuv

View 5iuv on RCSB PDB site
Description: Crystal Structure of Indole-3-acetaldehyde Dehydrogenase in complexed with NAD+
Class: oxidoreductase
Keywords: Indole-3-acetaldehyde dehydrogenase, aldehyde dehydrogenase, OXIDOREDUCTASE
Deposited on 2016-03-18, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde dehydrogenase family protein
    Species: Pseudomonas syringae pv. tomato (strain DC3000) [TaxId:223283]
    Gene: PSPTO_0092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iuva_
  • Chain 'B':
    Compound: Aldehyde dehydrogenase family protein
    Species: Pseudomonas syringae pv. tomato (strain DC3000) [TaxId:223283]
    Gene: PSPTO_0092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iuvb_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iuvA (A:)
    mttltradweqraqnlkiegrafiqgeytaaasgetfdcispvdgrllakvascdaadaq
    ravesarsafdsgawsrlapakrkatmirfaglleqnaeelalletldmgkpisdslgvd
    ipggaralswsgeaidklydevaatphdqlglvtrepvgvvaaivpwnfplmmacwklgp
    alstgnsvvlkpsekspltairiaqlaieagipagvlnvlpgyghtvgkalalhmdvdtv
    vftgstkiakqlmiyagesnmkrvwleaggkspnivfadapdlqaaadsaasaiafnqge
    vctagsrllversikdrflpmviealgtwkpgnpldpatnvgalvdtqqmntvlsyiaag
    htdgarlvaggkqilqetggtyveptifdgvnnamriaqeeifgpvlsvltfdtaeeaiq
    iandtpyglaaavwtanlskahltaralragsvwvnqydggdmtapfggfkqsgngrdks
    lhafdkytelkstwikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iuvA (A:)
    tltradweqraqnlkiegrafiqgeytaaasgetfdcispvdgrllakvascdaadaqra
    vesarsafdsgawsrlapakrkatmirfaglleqnaeelalletldmgkpisdslgvdip
    ggaralswsgeaidklydevaatphdqlglvtrepvgvvaaivpwnfplmmacwklgpal
    stgnsvvlkpsekspltairiaqlaieagipagvlnvlpgyghtvgkalalhmdvdtvvf
    tgstkiakqlmiyagesnmkrvwleaggkspnivfadapdlqaaadsaasaiafnqgevc
    tagsrllversikdrflpmviealgtwkpgnpldpatnvgalvdtqqmntvlsyiaaght
    dgarlvaggkqilqetggtyveptifdgvnnamriaqeeifgpvlsvltfdtaeeaiqia
    ndtpyglaaavwtanlskahltaralragsvwvnqydggdmtapfggfkqsgngrdkslh
    afdkytelkstwikl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iuvB (B:)
    mttltradweqraqnlkiegrafiqgeytaaasgetfdcispvdgrllakvascdaadaq
    ravesarsafdsgawsrlapakrkatmirfaglleqnaeelalletldmgkpisdslgvd
    ipggaralswsgeaidklydevaatphdqlglvtrepvgvvaaivpwnfplmmacwklgp
    alstgnsvvlkpsekspltairiaqlaieagipagvlnvlpgyghtvgkalalhmdvdtv
    vftgstkiakqlmiyagesnmkrvwleaggkspnivfadapdlqaaadsaasaiafnqge
    vctagsrllversikdrflpmviealgtwkpgnpldpatnvgalvdtqqmntvlsyiaag
    htdgarlvaggkqilqetggtyveptifdgvnnamriaqeeifgpvlsvltfdtaeeaiq
    iandtpyglaaavwtanlskahltaralragsvwvnqydggdmtapfggfkqsgngrdks
    lhafdkytelkstwikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iuvB (B:)
    tltradweqraqnlkiegrafiqgeytaaasgetfdcispvdgrllakvascdaadaqra
    vesarsafdsgawsrlapakrkatmirfaglleqnaeelalletldmgkpisdslgvdip
    ggaralswsgeaidklydevaatphdqlglvtrepvgvvaaivpwnfplmmacwklgpal
    stgnsvvlkpsekspltairiaqlaieagipagvlnvlpgyghtvgkalalhmdvdtvvf
    tgstkiakqlmiyagesnmkrvwleaggkspnivfadapdlqaaadsaasaiafnqgevc
    tagsrllversikdrflpmviealgtwkpgnpldpatnvgalvdtqqmntvlsyiaaght
    dgarlvaggkqilqetggtyveptifdgvnnamriaqeeifgpvlsvltfdtaeeaiqia
    ndtpyglaaavwtanlskahltaralragsvwvnqydggdmtapfggfkqsgngrdkslh
    afdkytelkstwikl