PDB entry 5isq

View 5isq on RCSB PDB site
Description: Staphylococcus aureus H30N, F98Y Dihydrofolate Reductase mutant complexed with beta-NADPH and 3'-(3-(2,4-diamino-6-ethylpyrimidin-5-yl)prop-2-yn-1-yl)-4'-methoxy-[1,1'-biphenyl]-4-carboxylic acid (UCP1106)
Class: oxidoreductase
Keywords: Oxidoreductase, Dihydrofolate Reductase, NADPH, Zwitterion, Antibiotics
Deposited on 2016-03-15, released 2017-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A017 (0-156)
      • engineered mutation (29)
      • engineered mutation (97)
    Domains in SCOPe 2.08: d5isqx_
  • Heterogens: NAP, U06, GOL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >5isqX (X:)
tlsilvahdlqrvigfenqlpwhlpndlknvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirkleh

    Sequence, based on observed residues (ATOM records): (download) 
    >5isqX (X:)
tlsilvahdlqrvigfenqlpwhlpndlknvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk