PDB entry 5iso

View 5iso on RCSB PDB site
Description: structure of full length human ampk (non-phosphorylated at t-loop) in complex with a small molecule activator, a benzimidazole derivative (991)
Class: transferase
Keywords: transferase, nucleotide-binding, activator, non-phosphorylation
Deposited on 2016-03-15, released 2017-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-AMP-activated protein kinase catalytic subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAA2, AMPK, AMPK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 5'-AMP-activated protein kinase subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAB1, AMPK
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 5'-AMP-activated protein kinase catalytic subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAA2, AMPK, AMPK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 5'-AMP-activated protein kinase subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAB1, AMPK
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkag1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5isoe1, d5isoe2
  • Chain 'F':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkag1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5isof1, d5isof2
  • Heterogens: STU, 992, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5isoE (E:)
    metvissdsspavenehpqetpesnnsvytsfmkshrcydliptssklvvfdtslqvkka
    ffalvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkietwrev
    ylqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkflklfi
    tefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdi
    yskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrl
    vvvdendvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5isoE (E:)
    svytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgml
    titdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssli
    rnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyaniam
    vrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvtkal
    qhrshyfegvlkcylhetletiinrlveaevhrlvvvdendvvkgivslsdilqalvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5isoF (F:)
    metvissdsspavenehpqetpesnnsvytsfmkshrcydliptssklvvfdtslqvkka
    ffalvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkietwrev
    ylqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkflklfi
    tefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdi
    yskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrl
    vvvdendvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5isoF (F:)
    svytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgml
    titdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssli
    rnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyaniam
    vrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvtkal
    qhrshyfegvlkcylhetletiinrlveaevhrlvvvdendvvkgivslsdilqalvlt