PDB entry 5ir3

View 5ir3 on RCSB PDB site
Description: Crystal structure of the recombinant highest fibrillogenic natural mutant (obtained from patient AR) derived from lambda 6 light chain variable domain
Class: immune system
Keywords: beta-sandwich, immunoglobulin, al amyloidosis, immune system
Deposited on 2016-03-11, released 2017-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ig lambda chain V-VI region AR
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01721 (0-End)
  Domains in SCOPe 2.08: d5ir3a_
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5ir3A (A:)
  dfmltqphsvsespgktvtfsctgsggsiadsfvqwyqqrpgsapttviyddnqrpsgvp
  drfsgsiddsansasltisglktedeadyycqsynsnhhvvfgggtkvtvlg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5ir3A (A:)
  dfmltqphsvsespgktvtfsctgsggsiadsfvqwyqqrpgsapttviyddnqrpsgvp
  drfsgsiddsansasltisglktedeadyycqsynsnhhvvfgggtkvtvl