PDB entry 5iqq

View 5iqq on RCSB PDB site
Description: Crystal structure of the human RBM7 RRM domain
Class: RNA binding protein
Keywords: pentameric assembly, RRM fold, non-crystallographic symmetry, RNA binding protein, NEXT complex, exosome, RNA degradation
Deposited on 2016-03-11, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iqqa_
  • Chain 'B':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iqqb_
  • Chain 'C':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iqqc_
  • Chain 'D':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iqqd_
  • Chain 'E':
    Compound: RNA-binding protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iqqe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iqqA (A:)
    mgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhe
    vsvpyamnllngiklygrpikiqfrsgssha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqqA (A:)
    aaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsv
    pyamnllngiklygrpikiqfrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iqqB (B:)
    mgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhe
    vsvpyamnllngiklygrpikiqfrsgssha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqqB (B:)
    adrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpyam
    nllngiklygrpikiqfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iqqC (C:)
    mgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhe
    vsvpyamnllngiklygrpikiqfrsgssha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqqC (C:)
    aaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevs
    vpyamnllngiklygrpikiqfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5iqqD (D:)
    mgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhe
    vsvpyamnllngiklygrpikiqfrsgssha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqqD (D:)
    aaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvp
    yamnllngiklygrpikiqfr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5iqqE (E:)
    mgaaaaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhe
    vsvpyamnllngiklygrpikiqfrsgssha
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqqE (E:)
    aeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpy
    amnllngiklygrpikiqfr