PDB entry 5iqp

View 5iqp on RCSB PDB site
Description: 14-3-3 protein tau isoform
Class: signaling protein
Keywords: MULTIPLE SIGNALLING PATHWAYS, PHOSPHORYLATION, BINDING TO KINASE, signaling protein
Deposited on 2016-03-11, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein theta
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iqpa_
  • Chain 'B':
    Compound: 14-3-3 protein theta
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iqpb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iqpA (A:)
    mekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawr
    vissieqktdtsdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylk
    mkgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyye
    ilnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwtsdsageecdaa
    egaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqpA (A:)
    mekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawr
    vissieqktdtsdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylk
    mkgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyye
    ilnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iqpB (B:)
    mekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawr
    vissieqktdtsdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylk
    mkgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyye
    ilnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwtsdsageecdaa
    egaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iqpB (B:)
    mekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawr
    vissieqktdtdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylkm
    kgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyyei
    lnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwts