PDB entry 5iq3

View 5iq3 on RCSB PDB site
Description: Crystal structure of Esterase mutant - F72G/L255W
Class: hydrolase
Keywords: Esterase, Est25, Hormone-Sensitive Lipase, HYDROLASE
Deposited on 2016-03-10, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4TZQ3 (Start-361)
      • engineered mutation (71)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5iq3a_
  • Chain 'B':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4TZQ3 (Start-361)
      • engineered mutation (71)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5iq3b_
  • Chain 'C':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4TZQ3 (Start-361)
      • engineered mutation (71)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5iq3c_
  • Chain 'D':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4TZQ3 (Start-361)
      • engineered mutation (71)
      • engineered mutation (254)
    Domains in SCOPe 2.07: d5iq3d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iq3A (A:)
    msnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciay
    staaeqawqtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcv
    vhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaa
    kwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyask
    peelpsllendayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvn
    eldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafays
    ra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iq3A (A:)
    snatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciays
    taaeqawqtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvv
    hthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaak
    wvasnrealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskp
    eelpsllendayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvne
    ldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysr
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iq3B (B:)
    msnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciay
    staaeqawqtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcv
    vhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaa
    kwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyask
    peelpsllendayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvn
    eldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafays
    ra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iq3B (B:)
    lpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqaw
    qtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthgggm
    viltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnre
    algistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsll
    endayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrde
    glahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iq3C (C:)
    msnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciay
    staaeqawqtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcv
    vhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaa
    kwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyask
    peelpsllendayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvn
    eldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafays
    ra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iq3C (C:)
    lpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqaw
    qtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthgggm
    viltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnre
    algistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsll
    endayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrde
    glahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5iq3D (D:)
    msnatlnqlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciay
    staaeqawqtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcv
    vhthgggmviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaa
    kwvasnrealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyask
    peelpsllendayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvn
    eldplrdeglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafays
    ra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iq3D (D:)
    lpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqaw
    qtlgamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthgggm
    viltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnre
    algistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsll
    endayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrde
    glahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra