PDB entry 5in1

View 5in1 on RCSB PDB site
Description: Crystal Structure of the MRG701 chromodomain
Class: transcription
Keywords: MRG701, chromodomain, TRANSCRIPTION
Deposited on 2016-03-07, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mrg701
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IN1 (Start-71)
    Domains in SCOPe 2.07: d5in1a_
  • Chain 'B':
    Compound: mrg701
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IN1 (Start-71)
    Domains in SCOPe 2.07: d5in1b_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5in1A (A:)
    gsfkegervlayhgpllyeakvqksenkedewryhvhylgwskswdewvtndrllkltde
    nirkqqeleksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5in1A (A:)
    sfkegervlayhgpllyeakvqksenkedewryhvhylgwskswdewvtndrllkltden
    irkqqeleksq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5in1B (B:)
    gsfkegervlayhgpllyeakvqksenkedewryhvhylgwskswdewvtndrllkltde
    nirkqqeleksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5in1B (B:)
    sfkegervlayhgpllyeakvqksenkedewryhvhylgwskswdewvtndrllkltden
    irkqqeleksq