PDB entry 5ilz

View 5ilz on RCSB PDB site
Description: Tobacco 5-epi-aristolochene synthase with BIS-TRIS propane (BTP) buffer molecule
Class: lyase
Keywords: terpene synthase, TEAS, BIS-TRIS propane, BTP, LYASE
Deposited on 2016-03-05, released 2017-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-epi-aristolochene synthase
    Species: Nicotiana tabacum [TaxId:4097]
    Gene: EAS3, EAS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ilza1, d5ilza2
  • Heterogens: B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ilzA (A:)
    gsmasaavanyeeeivrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmll
    atgmkladtlnlidtierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhg
    fnispeifskfqdengkfkeslasdvlgllnlyeashvrthaddiledalafstihlesa
    aphlksplreqvthaleqclhkgvprvetrffissiydkeqsknnvllrfakldfnllqm
    lhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfepqysqarvmlvktismis
    ivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisykaildlykdyekelssagr
    shivchaiermkevvrnynvestwfiegytppvseylsnalatttyyylattsylgmksa
    teqdfewlsknpkileasviicrviddtatyeveksrgqiatgieccmrdygistkeama
    kfqnmaetawkdinegllrptpvstefltpilnlarivevtyihnldgythpekvlkphi
    inllvdsiki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ilzA (A:)
    ivrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlid
    tierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqde
    ngkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvth
    aleqclhkgvprvetrffissiydkeqsknnvllrfakldfnllqmlhkqelaqvsrwwk
    dldfvttlpyardrvvecyfwalgvyfepqysqarvmlvktismisivddtfdaygtvke
    leaytdaiqrwdineidrlpdymkisykaildlykdyekelssagrshivchaiermkev
    vrnynvestwfiegytppvseylsnalatttyyylattsylgmksateqdfewlsknpki
    leasviicrviddtatyeveksrgqiatgieccmrdygistkeamakfqnmaetawkdin
    egllrptpvstefltpilnlarivevtyihnldgythpekvlkphiinllvdsiki