PDB entry 5ilu

View 5ilu on RCSB PDB site
Description: Autoinhibited ETV4
Class: DNA binding protein
Keywords: ETV4, ETS, transcription factor, autoinhibition transcription, DNA binding, DNA BINDING PROTEIN
Deposited on 2016-03-04, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ets translocation variant 4
  Species: Homo sapiens [TaxId:9606]
  Gene: ETV4, E1AF, PEA3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43268 (0-96)
  Domains in SCOPe 2.06: d5ilua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5iluA (A:)
  alqlwqflvallddptnahfiawtgrgmefkliepeevarlwgiqknrpamnydklsrsl
  ryyyekgimqkvageryvykfvcepealfslafpdnq