PDB entry 5ijv

View 5ijv on RCSB PDB site
Description: Crystal structure of bovine Fab E03
Class: immune system
Keywords: antibody fab ultralong CDR H3, IMMUNE SYSTEM
Deposited on 2016-03-02, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine Fab E03 light chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IJV
    Domains in SCOPe 2.07: d5ijva1, d5ijva2
  • Chain 'B':
    Compound: bovine Fab E03 heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IJV (Start-253)
  • Chain 'C':
    Compound: bovine Fab E03 light chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IJV
    Domains in SCOPe 2.07: d5ijvc1, d5ijvc2
  • Chain 'D':
    Compound: bovine Fab E03 heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IJV (Start-253)
  • Chain 'E':
    Compound: bovine Fab E03 light chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IJV
    Domains in SCOPe 2.07: d5ijve1, d5ijve2
  • Chain 'F':
    Compound: bovine Fab E03 heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IJV (Start-253)
  • Chain 'H':
    Compound: bovine Fab E03 heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IJV
  • Chain 'L':
    Compound: bovine Fab E03 light chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IJV
    Domains in SCOPe 2.07: d5ijvl1, d5ijvl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ijvA (A:)
    qavlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvp
    drfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvt
    lfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaass
    ylsltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ijvA (A:)
    vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
    fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ijvC (C:)
    qavlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvp
    drfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvt
    lfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaass
    ylsltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ijvC (C:)
    vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
    fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsec
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ijvE (E:)
    qavlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvp
    drfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvt
    lfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaass
    ylsltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ijvE (E:)
    vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
    fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsec
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ijvL (L:)
    qavlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvp
    drfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvt
    lfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaass
    ylsltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ijvL (L:)
    vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
    fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsec