PDB entry 5iju

View 5iju on RCSB PDB site
Description: Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound
Class: oxidoreductase
Keywords: lytic polysaccharide monooxygenase, copper II, CAZy AA10, oxidoreductase
Deposited on 2016-03-02, released 2016-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BaAA10 Lytic Polysaccharide Monooxygenase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: RBAM17540, BAMF_1859
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijua_
  • Chain 'B':
    Compound: BaAA10 Lytic Polysaccharide Monooxygenase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Gene: RBAM17540, BAMF_1859
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ijub_
  • Heterogens: CU, EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ijuA (A:)
    hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
    ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
    defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ijuA (A:)
    hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
    ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
    defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ijuB (B:)
    hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
    ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
    defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ijuB (B:)
    hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
    ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
    defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt