PDB entry 5ihz

View 5ihz on RCSB PDB site
Description: Crystal structure of anti-gliadin 1002-1E01 Fab fragment
Class: immune system
Keywords: anti-gliadin antibody, celiac disease, IMMUNE SYSTEM
Deposited on 2016-03-01, released 2017-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1E01 Fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHZ
  • Chain 'B':
    Compound: 1E01 Fab fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHZ (0-End)
    Domains in SCOPe 2.06: d5ihzb1, d5ihzb2
  • Chain 'C':
    Compound: 1E01 Fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHZ (0-End)
  • Chain 'D':
    Compound: 1E01 Fab fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHZ (0-End)
    Domains in SCOPe 2.06: d5ihzd1, d5ihzd2
  • Chain 'E':
    Compound: 1E01 Fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHZ
  • Chain 'F':
    Compound: 1E01 Fab fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHZ (0-End)
    Domains in SCOPe 2.06: d5ihzf1, d5ihzf2
  • Chain 'H':
    Compound: 1E01 Fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHZ (0-End)
  • Chain 'L':
    Compound: 1E01 Fab fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHZ (0-End)
    Domains in SCOPe 2.06: d5ihzl1, d5ihzl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ihzB (B:)
    qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
    gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihzB (B:)
    qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
    gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ihzD (D:)
    qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
    gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihzD (D:)
    qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
    gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ihzF (F:)
    qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
    gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihzF (F:)
    qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
    gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ihzL (L:)
    qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
    gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihzL (L:)
    qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
    gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapte