PDB entry 5ihu

View 5ihu on RCSB PDB site
Description: Crystal structure of bovine Fab B11
Class: immune system
Keywords: antibody fab ultralong CDRH3, IMMUNE SYSTEM
Deposited on 2016-02-29, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: bovine Fab B11 heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHU (0-272)
  • Chain 'L':
    Compound: bovine Fab B11 light chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IHU
    Domains in SCOPe 2.07: d5ihul1, d5ihul2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ihuL (L:)
    qavlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvp
    drfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvt
    lfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaass
    ylsltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihuL (L:)
    vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
    fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsec